General Information

  • ID:  hor004154
  • Uniprot ID:  P01142
  • Protein name:  Corticoliberin
  • Gene name:  CRH
  • Organism:  Ovis aries (Sheep)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  Produced by the hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0001963 synaptic transmission, dopaminergic; GO:0007165 signal transduction; GO:2000310 regulation of NMDA receptor activity
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
  • Length:  41(148-188)
  • Propeptide:  MRLPLLVSVGVLLVALLPSPPCRALLSRGPIPGARQASQHPQPLSFFQPLPQPQEPQALPTLLRVGEEYFLRLGNLDETRAAPLSPAASPLASRSSSRLSPDKVAANFFRALLQPRRPLDSPAGPAKRGTENALGSRQEAPAARKRRSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIAGK
  • Signal peptide:  MRLPLLVSVGVLLVALLPSPPCRA
  • Modification:  T41 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulate the release of corticotropin from pituitary gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CRHR2, CRHR1
  • Target Unid:   W5PDF3, W5PNE7
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  The plasma half-life of IR-CRF was 11.6 +/- 1.5 min (mean +/- SE) for the fast component and 73 +/- 8 min for the slow component. ( PubMed ID: 6605972 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01142-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004154_AF2.pdbhor004154_ESM.pdb

Physical Information

Mass: 538504 Formula: C205H338N58O64S
Absent amino acids: CGWY Common amino acids: L
pI: 5.52 Basic residues: 6
Polar residues: 6 Hydrophobic residues: 16
Hydrophobicity: -32.2 Boman Index: -7518
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 111.95
Instability Index: 3403.66 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  6273874
  • Title:  Primary structure of corticotropin-releasing factor from ovine hypothalamus.
  • PubMed ID:  6267699
  • Title:  Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin.
  • PubMed ID:  2647152
  • Title:  Structural characterization and localization of corti
  • PubMed ID:  6605972
  • Title: