HORDB

ID: hor004154
Uniprot ID: P01142(148-188)
Protein name: Corticoliberin
Gene name: CRH
Organism: Ovis aries (Sheep)
Family: Sauvagine/corticotropin-releasing factor/urotensin I family
Source: animal
Expression: Produced by the hypothalamus.
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0001963 synaptic transmission, dopaminergic; GO:0007165 signal transduction; GO:2000310 regulation of NMDA receptor activity
GO CC: GO:0005576 extracellular region; GO:0045202 synapse

Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
Length: 41(148-188)
Propeptide: MRLPLLVSVGVLLVALLPSPPCRALLSRGPIPGARQASQHPQPLSFFQPLPQPQEPQALPTLLRVGEEYFLRLGNLDETRAAPLSPAASPLASRSSSRLSPDKVAANFFRALLQPRRPLDSPAGPAKRGTENALGSRQEAPAARKRRSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIAGK
Signal peptide: MRLPLLVSVGVLLVALLPSPPCRA
Modification: T41 Alanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Regulate the release of corticotropin from pituitary gland
Mechanism: NA
Cross BBB: NA
Target: CRHR2, CRHR1
Target Unid: W5PDF3, W5PNE7
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: The plasma half-life of IR-CRF was 11.6 +/- 1.5 min (mean +/- SE) for the fast component and 73 +/- 8 min for the slow component. ( PubMed ID: 6605972 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004154_AF2.pdb

hor004154_ESM.pdb

Mass:	538504	Formula:	C205H338N58O64S
Absent amino acids:	CGWY	Common amino acids:	L
pI:	5.52	Basic residues:	6
Polar residues:	6	Hydrophobic residues:	16
Hydrophobicity:	-32.2	Boman Index:	-7518
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	111.95
Instability Index:	3403.66	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 6273874
Title: Primary structure of corticotropin-releasing factor from ovine hypothalamus.
PubMed ID: 6267699
Title: Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin.
PubMed ID: 2647152
Title: Structural characterization and localization of corti
PubMed ID: 6605972
Title: